SH2D3C antibody (N-Term)

Catalog No. ABIN634344

This anti-SH2D3C antibody is a Rabbit Polyclonal antibody detecting SH2D3C in WB. Suitable for Human, Mouse and Rat.

Quick Overview for SH2D3C antibody (N-Term) (ABIN634344)

Target: SH2D3C (SH2 Domain Containing 3C (SH2D3C))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SH2D3C antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SH2D3C Antibody

Binding Specificity: N-Term

Specificity: SH2 D2 antibody was raised against the N terminal of SH2 2

Purification: Affinity purified

Immunogen: SH2 D2 antibody was raised using the N terminal of SH2 2 corresponding to a region with amino acids AGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPRE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SH2D3C Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this SH2D3C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SH2D3C

Target: SH2D3C (SH2 Domain Containing 3C (SH2D3C))

Alternative Name: SH2D3C

Background: SH2D3C is an Eph receptor-binding protein which may be a positive regulator of TCR signaling. Binding to BCAR1 of SH2D3C is required to induce membrane ruffling and promote EGF-dependent cell migration.

Molecular Weight: 77 kDa (MW of target protein)