CAMKII gamma antibody (N-Term)
-
- Target See all CAMKII gamma (CAMK2G) Antibodies
- CAMKII gamma (CAMK2G) (Calcium/calmodulin-Dependent Protein Kinase II gamma (CAMK2G))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CAMKII gamma antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CAMKII antibody was raised against the N terminal of CAMKK2
- Purification
- Affinity purified
- Immunogen
- CAMKII antibody was raised using the N terminal of CAMKK2 corresponding to a region with amino acids GGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGM
- Top Product
- Discover our top product CAMK2G Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CAMKII Blocking Peptide, catalog no. 33R-3291, is also available for use as a blocking control in assays to test for specificity of this CAMKII antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAMKK2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CAMKII gamma (CAMK2G) (Calcium/calmodulin-Dependent Protein Kinase II gamma (CAMK2G))
- Alternative Name
- CAMKII (CAMK2G Products)
- Background
- CAMKK2 is a calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade involved in a number of cellular processes. Isoform 1, isoform 2 and isoform 3 phosphorylate CAMK1 and CAMK4. Isoform 3 phosphorylates CAMK1D. Isoform 4, isoform 5 and isoform 6 lacking part of the calmodulin-binding domain are inactive. CAMKK2 seems to be involved in hippocampal activation of CREB1.
- Molecular Weight
- 55 kDa (MW of target protein)
- Pathways
- WNT Signaling, Interferon-gamma Pathway, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of long-term Neuronal Synaptic Plasticity
-