DDAH1 antibody (Middle Region)

Catalog No. ABIN634364

The Rabbit Polyclonal anti-DDAH1 antibody is suitable to detect DDAH1 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for DDAH1 antibody (Middle Region) (ABIN634364)

Target: DDAH1 (Dimethylarginine Dimethylaminohydrolase 1 (DDAH1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDAH1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DDAH1 Antibody

Binding Specificity: Middle Region

Specificity: DDAH1 antibody was raised against the middle region of DDAH1

Purification: Affinity purified

Immunogen: DDAH1 antibody was raised using the middle region of DDAH1 corresponding to a region with amino acids ALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDAH1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this DDAH1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDAH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDAH1

Target: DDAH1 (Dimethylarginine Dimethylaminohydrolase 1 (DDAH1))

Alternative Name: DDAH1

Background: DDAH1 belongs to the dimethylarginine dimethylaminohydrolase (DDAH) family. This enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity.

Molecular Weight: 31 kDa (MW of target protein)