DDAH2 antibody (N-Term)

Catalog No. ABIN634365

This anti-DDAH2 antibody is a Rabbit Polyclonal antibody detecting DDAH2 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for DDAH2 antibody (N-Term) (ABIN634365)

Target: DDAH2 (Dimethylarginine Dimethylaminohydrolase 2 (DDAH2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDAH2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DDAH2 Antibody

Binding Specificity: N-Term

Specificity: DDAH2 antibody was raised against the N terminal of DDAH2

Purification: Affinity purified

Immunogen: DDAH2 antibody was raised using the N terminal of DDAH2 corresponding to a region with amino acids MYTLHTKRVKAAARQMWTSNLSKVRQSLKNVYHKCKIRHQDSTGYPTVTS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDAH2 Blocking Peptide, (ABIN5613148), is also available for use as a blocking control in assays to test for specificity of this DDAH2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDAH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDAH2

Target: DDAH2 (Dimethylarginine Dimethylaminohydrolase 2 (DDAH2))

Alternative Name: DDAH2

Background: DDAH2 hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. DDAH2 has therefore a role in nitric oxide generation.

Molecular Weight: 31 kDa (MW of target protein)