SH3BP2 antibody (Middle Region)

Catalog No. ABIN634378

Product Details anti-SH3BP2 Antibody

Target: SH3BP2 (SH3-Domain Binding Protein 2 (SH3BP2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SH3BP2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SH3 BP2 antibody was raised against the middle region of SH3 P2

Purification: Affinity purified

Immunogen: SH3 BP2 antibody was raised using the middle region of SH3 P2 corresponding to a region with amino acids RQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SH3BP2 Blocking Peptide, catalog no. 33R-8125, is also available for use as a blocking control in assays to test for specificity of this SH3BP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 P2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SH3BP2

Target: SH3BP2 (SH3-Domain Binding Protein 2 (SH3BP2))

Alternative Name: SH3BP2 (SH3BP2 Products)

Synonyms: SH3BP2 antibody, 3BP-2 antibody, 3BP2 antibody, CRBM antibody, CRPM antibody, SH3 domain binding protein 2 antibody, SH3-domain binding protein 2 antibody, SH3BP2 antibody, Sh3bp2 antibody

Background: SH3BP2 has an N-terminal pleckstrin homology (PH) domain, an SH3-binding proline-rich region, and a C-terminal SH2 domain. The protein binds to the SH3 domains of several proteins including the ABL1 and SYK protein tyrosine kinases, and functions as a cytoplasmic adaptor protein to positively regulate transcriptional activity in T, natural killer (NK), and basophilic cells. Mutations in this gene result in cherubism.

Molecular Weight: 62 kDa (MW of target protein)

Pathways: TCR Signaling