RAB5 antibody (Middle Region)

Catalog No. ABIN634386

This anti-RAB5 antibody is a Rabbit Polyclonal antibody detecting RAB5 in WB. Suitable for Human, Mouse, Rat and Dog.

Quick Overview for RAB5 antibody (Middle Region) (ABIN634386)

Target: RAB5 (RAB5A) (RAB5A, Member RAS Oncogene Family (RAB5A))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAB5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RAB5 Antibody

Binding Specificity: Middle Region

Specificity: RAB5 A antibody was raised against the middle region of RAB5

Purification: Affinity purified

Immunogen: RAB5 A antibody was raised using the middle region of RAB5 corresponding to a region with amino acids KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAB5A Blocking Peptide, (ABIN940077), is also available for use as a blocking control in assays to test for specificity of this RAB5A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAB5

Target: RAB5 (RAB5A) (RAB5A, Member RAS Oncogene Family (RAB5A))

Alternative Name: RAB5A

Background: RAB5A is required for the fusion of plasma membranes and early endosomes.

Molecular Weight: 24 kDa (MW of target protein)

Pathways: Smooth Muscle Cell Migration, Regulation of long-term Neuronal Synaptic Plasticity