Pleckstrin antibody (N-Term)

Catalog No. ABIN634412

Product Details anti-Pleckstrin Antibody

Target: Pleckstrin (PLEK)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Pleckstrin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PLEK antibody was raised against the N terminal of PLEK

Purification: Affinity purified

Immunogen: PLEK antibody was raised using the N terminal of PLEK corresponding to a region with amino acids MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PLEK Blocking Peptide, catalog no. 33R-5943, is also available for use as a blocking control in assays to test for specificity of this PLEK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLEK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Pleckstrin

Target: Pleckstrin (PLEK)

Alternative Name: PLEK (PLEK Products)

Synonyms: MGC69065 antibody, PLEK antibody, P47 antibody, 2010300B13Rik antibody, pleckstrin L homeolog antibody, pleckstrin antibody, plek.L antibody, PLEK antibody, Plek antibody

Background: PLEK is a major protein kinase C substrate of platelets, its exact function is not known.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: Inositol Metabolic Process, Regulation of G-Protein Coupled Receptor Protein Signaling, Regulation of Cell Size, Regulation of Carbohydrate Metabolic Process