RAB40B antibody (Middle Region)

Catalog No. ABIN634429

This Rabbit Polyclonal antibody specifically detects RAB40B in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for RAB40B antibody (Middle Region) (ABIN634429)

Target: RAB40B (RAB40B, Member RAS Oncogene Family (RAB40B))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAB40B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RAB40B Antibody

Binding Specificity: Middle Region

Specificity: RAB40 B antibody was raised against the middle region of RAB40

Purification: Affinity purified

Immunogen: RAB40 B antibody was raised using the middle region of RAB40 corresponding to a region with amino acids YAERLGVTFFEVSPLCNFNITESFTELARIVLLRHGMDRLWRPSKVLSLQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAB40B Blocking Peptide, (ABIN936001), is also available for use as a blocking control in assays to test for specificity of this RAB40B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAB40B

Target: RAB40B (RAB40B, Member RAS Oncogene Family (RAB40B))

Alternative Name: RAB40B

Background: RAB40B has similarity to a yeast protein which suggests a role of the gene product in regulating secretory vesicles.

Molecular Weight: 31 kDa (MW of target protein)