NKIRAS2 antibody (Middle Region)

Catalog No. ABIN634432

Product Details anti-NKIRAS2 Antibody

Target: NKIRAS2 (NFKB Inhibitor Interacting Ras-Like 2 (NKIRAS2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NKIRAS2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NKIRAS2 antibody was raised against the middle region of NKIRAS2

Purification: Affinity purified

Immunogen: NKIRAS2 antibody was raised using the middle region of NKIRAS2 corresponding to a region with amino acids KKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NKIRAS2 Blocking Peptide, catalog no. 33R-4460, is also available for use as a blocking control in assays to test for specificity of this NKIRAS2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NKIRAS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NKIRAS2

Target: NKIRAS2 (NFKB Inhibitor Interacting Ras-Like 2 (NKIRAS2))

Alternative Name: NKIRAS2 (NKIRAS2 Products)

Synonyms: NKIRAS2 antibody, KBRAS2 antibody, kappaB-Ras2 antibody, zgc:92870 antibody, 2410003M04Rik antibody, 4930527H08Rik antibody, D630018G21Rik antibody, NFKB inhibitor interacting Ras like 2 antibody, NFKB inhibitor interacting Ras-like 2 antibody, NFKB inhibitor interacting Ras like 2 L homeolog antibody, NFKB inhibitor interacting Ras-like protein 2 antibody, NKIRAS2 antibody, Nkiras2 antibody, nkiras2 antibody, nkiras2.L antibody

Background: NPAL2 is a multi-pass membrane protein and it belongs to the NIPA family. The exact function of NPAL2 remains unknown.

Molecular Weight: 21 kDa (MW of target protein)