G3BP1 antibody

Catalog No. ABIN634465

Product Details anti-G3BP1 Antibody

Target: G3BP1 (GTPase Activating Protein (SH3 Domain) Binding Protein 1 (G3BP1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This G3BP1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: G3 BP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

G3BP1 Blocking Peptide, catalog no. 33R-7905, is also available for use as a blocking control in assays to test for specificity of this G3BP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of G0 P1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for G3BP1

Target: G3BP1 (GTPase Activating Protein (SH3 Domain) Binding Protein 1 (G3BP1))

Alternative Name: G3BP1 (G3BP1 Products)

Background: This gene encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome