WWP1 antibody (N-Term)

Catalog No. ABIN634475

Product Details anti-WWP1 Antibody

Target: WWP1 (WW Domain Containing E3 Ubiquitin Protein Ligase 1 (WWP1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WWP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WWP1 antibody was raised against the N terminal of WWP1

Purification: Affinity purified

Immunogen: WWP1 antibody was raised using the N terminal of WWP1 corresponding to a region with amino acids ATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEIT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WWP1 Blocking Peptide, catalog no. 33R-1550, is also available for use as a blocking control in assays to test for specificity of this WWP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WWP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WWP1

Target: WWP1 (WW Domain Containing E3 Ubiquitin Protein Ligase 1 (WWP1))

Alternative Name: WWP1 (WWP1 Products)

Synonyms: AIP5 antibody, Tiul1 antibody, hSDRP1 antibody, 8030445B08Rik antibody, SDRP1 antibody, WWP1 antibody, aip5 antibody, tiul1 antibody, hsdrp1 antibody, WW domain containing E3 ubiquitin protein ligase 1 antibody, WWP1 antibody, Wwp1 antibody, wwp1 antibody

Background: WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. WWP1 is a protein which contains 4 tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. WWP1 belongs to a family of NEDD4-like proteins, which are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes.WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing.

Molecular Weight: 105 kDa (MW of target protein)