CCRL2 antibody

Catalog No. ABIN634522

Product Details anti-CCRL2 Antibody

Target: CCRL2 (Chemokine (C-C Motif) Receptor-Like 2 (CCRL2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCRL2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CCRL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCRL2 Blocking Peptide, catalog no. 33R-5410, is also available for use as a blocking control in assays to test for specificity of this CCRL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCRL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCRL2

Target: CCRL2 (Chemokine (C-C Motif) Receptor-Like 2 (CCRL2))

Alternative Name: CCRL2 (CCRL2 Products)

Synonyms: CCRL2 antibody, ACKR5 antibody, CKRX antibody, CRAM antibody, CRAM-A antibody, CRAM-B antibody, HCR antibody, 1810047I05Rik antibody, Ackr5 antibody, CCR11 antibody, Cmkbr1l2 antibody, E01 antibody, L-CCR antibody, C-C motif chemokine receptor like 2 antibody, chemokine (C-C motif) receptor-like 2 antibody, Ccrl2 antibody, CCRL2 antibody

Background: CCRL2 is a chemokine receptor like protein, which is predicted to be a seven transmembrane protein and most closely related to CCR1. Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. CCRL2 gene is expressed at high levels in primary neutrophils and primary monocytes, and is further upregulated on neutrophil activation and during monocyte to macrophage differentiation. The function of this gene is unknown.

Molecular Weight: 39 kDa (MW of target protein)