FKBP8 antibody (N-Term)

Catalog No. ABIN634523

The Rabbit Polyclonal anti-FKBP8 antibody has been validated for WB. It is suitable to detect FKBP8 in samples from Human, Mouse and Rat.

Quick Overview for FKBP8 antibody (N-Term) (ABIN634523)

Target: FKBP8 (FK506 Binding Protein 8, 38kDa (FKBP8))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FKBP8 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FKBP8 Antibody

Binding Specificity: N-Term

Specificity: FKBP8 antibody was raised against the N terminal of FKBP8

Purification: Affinity purified

Immunogen: FKBP8 antibody was raised using the N terminal of FKBP8 corresponding to a region with amino acids GPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FKBP8 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this FKBP8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBP8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FKBP8

Target: FKBP8 (FK506 Binding Protein 8, 38kDa (FKBP8))

Alternative Name: FKBP8

Background: FKBP8 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. Unlike the other members of the family, it does not seem to have PPIase/rotamase activity. It may have a role in neurons associated with memory function.

Molecular Weight: 45 kDa (MW of target protein)

Pathways: Autophagy