TLR9 antibody (N-Term)
-
- Target See all TLR9 Antibodies
- TLR9 (Toll-Like Receptor 9 (TLR9))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TLR9 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TLR9 antibody was raised against the N terminal of TLR9
- Purification
- Affinity purified
- Immunogen
- TLR9 antibody was raised using the N terminal of TLR9 corresponding to a region with amino acids VGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN
- Top Product
- Discover our top product TLR9 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TLR9 Blocking Peptide, catalog no. 33R-9556, is also available for use as a blocking control in assays to test for specificity of this TLR9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TLR9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TLR9 (Toll-Like Receptor 9 (TLR9))
- Alternative Name
- TLR9 (TLR9 Products)
- Background
- TLR9 participates in the innate immune response to microbial agents. TLR9 detects the unmethylated cytidine-phosphate-guanosine (CpG) motifs present in bacterial DNA. TLR9 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.
- Molecular Weight
- 113 kDa (MW of target protein)
- Pathways
- TLR Signaling, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Toll-Like Receptors Cascades
-