NMBR antibody (N-Term)

Catalog No. ABIN634529

The Rabbit Polyclonal anti-NMBR antibody has been validated for WB. It is suitable to detect NMBR in samples from Human.

Quick Overview for NMBR antibody (N-Term) (ABIN634529)

Target: NMBR (Neuromedin B Receptor (NMBR))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NMBR antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NMBR Antibody

Binding Specificity: N-Term

Specificity: NMBR antibody was raised against the N terminal of NMBR

Purification: Affinity purified

Immunogen: NMBR antibody was raised using the N terminal of NMBR corresponding to a region with amino acids PSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NMBR Blocking Peptide, (ABIN5615008), is also available for use as a blocking control in assays to test for specificity of this NMBR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NMBR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NMBR

Target: NMBR (Neuromedin B Receptor (NMBR))

Alternative Name: NMBR

Background: Neuromedin B receptor binds neuromedin B, a potent mitogen and growth factor for normal and neoplastic lung and for gastrointestinal epithelial tissue.

Molecular Weight: 43 kDa (MW of target protein)