KLRA1 antibody (N-Term)
-
- Target See all KLRA1 Antibodies
- KLRA1 (Killer Cell Lectin-Like Receptor, Subfamily A, Member 1 (KLRA1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KLRA1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KLRA1 antibody was raised against the N terminal of KLRA1
- Purification
- Affinity purified
- Immunogen
- KLRA1 antibody was raised using the N terminal of KLRA1 corresponding to a region with amino acids NDQGEIYSTLRFLQSPSESQNRLRPDDTQRPGKTDDKEFSVPWHLIAVTL
- Top Product
- Discover our top product KLRA1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KLRA1 Blocking Peptide, catalog no. 33R-6660, is also available for use as a blocking control in assays to test for specificity of this KLRA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLRA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KLRA1 (Killer Cell Lectin-Like Receptor, Subfamily A, Member 1 (KLRA1))
- Alternative Name
- KLRA1 (KLRA1 Products)
- Background
- Ly-49 Receptors or killer cell lectin-like receptor subfamily A (KLRA), member 1, are a class of natural killer cell receptor. Ly-49 proteins are a diverse set of C-type lectins that are expressed on NK cells in some mammals, including rodents but not humans. Their primary function is to bind host MHC class I as a mechanism of self/health recognition. Upon binding ligands, most Ly-49 receptors will deliver an inhibitory signal, preventing killing of the target cell.
- Molecular Weight
- 25 kDa (MW of target protein)
-