ADCY10 antibody (N-Term)

Catalog No. ABIN634544

Product Details anti-ADCY10 Antibody

Target: ADCY10 (Adenylate Cyclase 10 (Soluble) (ADCY10))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADCY10 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SAC antibody was raised against the N terminal Of Sac

Purification: Affinity purified

Immunogen: SAC antibody was raised using the N terminal Of Sac corresponding to a region with amino acids VGHTVRHEYTVIGQKVNLAARMMMYYPGIVTCDSVTYNGSNLPAYFFKEL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SAC Blocking Peptide, catalog no. 33R-9558, is also available for use as a blocking control in assays to test for specificity of this SAC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADCY10

Target: ADCY10 (Adenylate Cyclase 10 (Soluble) (ADCY10))

Alternative Name: SAC (ADCY10 Products)

Synonyms: HCA2 antibody, RP1-313L4.2 antibody, SAC antibody, SACI antibody, Sacy antibody, Sac antibody, 4930431D04Rik antibody, 4931412F17 antibody, sAC antibody, ADCY10 antibody, SACY antibody, adenylate cyclase 10 antibody, adenylate cyclase 10 (soluble) antibody, ADCY10 antibody, Adcy10 antibody

Background: SAC belongs to a distinct class of mammalian adenylyl cyclase that is soluble and insensitive to G protein or forskolin regulation. It is localized in the cytoplasm and is thought to function as a general bicarbonate sensor throughout the body. It may also play an important role in the generation of cAMP in spermatozoa, implying possible roles in sperm maturation through the epididymis, capacitation, hypermotility, and/or the acrosome reaction.

Molecular Weight: 187 kDa (MW of target protein)

Pathways: cAMP Metabolic Process