TLR5 antibody (N-Term)

Catalog No. ABIN634552

This Rabbit Polyclonal antibody specifically detects TLR5 in WB. It exhibits reactivity toward Human.

Quick Overview for TLR5 antibody (N-Term) (ABIN634552)

Target: TLR5 (Toll-Like Receptor 5 (TLR5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TLR5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TLR5 Antibody

Binding Specificity: N-Term

Specificity: TLR5 antibody was raised against the N terminal of TLR5

Purification: Affinity purified

Immunogen: TLR5 antibody was raised using the N terminal of TLR5 corresponding to a region with amino acids QLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TLR5 Blocking Peptide, (ABIN5616638), is also available for use as a blocking control in assays to test for specificity of this TLR5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TLR5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TLR5

Target: TLR5 (Toll-Like Receptor 5 (TLR5))

Alternative Name: TLR5

Background: TLR5 participates in the innate immune response to microbial agents. It mediates detection of bacterial flagellins. TLR5 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.

Molecular Weight: 98 kDa (MW of target protein)

Pathways: TLR Signaling, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Toll-Like Receptors Cascades