ULBP1 antibody (N-Term)

Catalog No. ABIN634554

This anti-ULBP1 antibody is a Rabbit Polyclonal antibody detecting ULBP1 in WB. Suitable for Human.

Quick Overview for ULBP1 antibody (N-Term) (ABIN634554)

Target: ULBP1 (UL16 Binding Protein 1 (ULBP1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ULBP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ULBP1 Antibody

Binding Specificity: N-Term

Specificity: ULBP1 antibody was raised against the N terminal of ULBP1

Purification: Affinity purified

Immunogen: ULBP1 antibody was raised using the N terminal of ULBP1 corresponding to a region with amino acids MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ULBP1 Blocking Peptide, (ABIN5616905), is also available for use as a blocking control in assays to test for specificity of this ULBP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ULBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ULBP1

Target: ULBP1 (UL16 Binding Protein 1 (ULBP1))

Alternative Name: ULBP1

Background: ULBP1 is the ligand for the NKG2D receptor, together with at least ULBP2 and ULBP3. ULBPs activate multiple signaling pathways in primary NK cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands to NKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transduction pathway. In CMV infected cells, interacts with soluble CMV glycoprotein UL16. The interaction with UL16 blocked the interaction with the NKG2D receptor, providing a mechanism by which CMV infected cells might escape the immune system. UL16 also causes ULBP1 to be retained in the ER and cis-Golgi apparatus so that it does not reach the cell surface.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process