CD8B antibody (N-Term)

Catalog No. ABIN634561

This Rabbit Polyclonal antibody specifically detects CD8B in WB. It exhibits reactivity toward Human.

Quick Overview for CD8B antibody (N-Term) (ABIN634561)

Target: CD8B (CD8b Molecule (CD8B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CD8B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CD8B Antibody

Binding Specificity: N-Term

Specificity: CD8 B antibody was raised against the N terminal of CD8

Purification: Affinity purified

Immunogen: CD8 B antibody was raised using the N terminal of CD8 corresponding to a region with amino acids RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CD8B Blocking Peptide, (ABIN5612764), is also available for use as a blocking control in assays to test for specificity of this CD8B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CD8B

Target: CD8B (CD8b Molecule (CD8B))

Alternative Name: CD8B

Background: The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognise antigen displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. CD8B is the CD8 beta chain isoforms.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: TCR Signaling