DGKE antibody (N-Term)

Catalog No. ABIN634569

Product Details anti-DGKE Antibody

Target: DGKE (Diacylglycerol Kinase, epsilon 64kDa (DGKE))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DGKE antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DGKE antibody was raised against the N terminal of DGKE

Purification: Affinity purified

Immunogen: DGKE antibody was raised using the N terminal of DGKE corresponding to a region with amino acids EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DGKE Blocking Peptide, catalog no. 33R-2256, is also available for use as a blocking control in assays to test for specificity of this DGKE antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGKE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DGKE

Target: DGKE (Diacylglycerol Kinase, epsilon 64kDa (DGKE))

Alternative Name: DGKE (DGKE Products)

Synonyms: MGC81643 antibody, DGKE antibody, C87606 antibody, DAGK6 antibody, DGK antibody, DAGK5 antibody, NPHS7 antibody, diacylglycerol kinase epsilon S homeolog antibody, diacylglycerol kinase epsilon antibody, diacylglycerol kinase, epsilon antibody, dgke.S antibody, DGKE antibody, dgke antibody, LOC5575244 antibody, Dgke antibody

Background: Diacylglycerol kinases are thought to be involved mainly in the regeneration of phosphatidylinositol (PI) from diacylglycerol in the PI-cycle during cell signal transduction. When expressed in mammalian cells, DGK-epsilon shows specificity for arachidonyl-containing diacylglycerol. DGK-epsilon is expressed predominantly in testis.

Molecular Weight: 64 kDa (MW of target protein)