CALCRL antibody (N-Term)

Catalog No. ABIN634576

Product Details anti-CALCRL Antibody

Target: CALCRL (Calcitonin Receptor-Like (CALCRL))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CALCRL antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CALCRL antibody was raised against the N terminal of CALCRL

Purification: Affinity purified

Immunogen: CALCRL antibody was raised using the N terminal of CALCRL corresponding to a region with amino acids DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CALCRL Blocking Peptide, catalog no. 33R-1962, is also available for use as a blocking control in assays to test for specificity of this CALCRL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CALCRL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CALCRL

Target: CALCRL (Calcitonin Receptor-Like (CALCRL))

Alternative Name: CALCRL (CALCRL Products)

Synonyms: CALCRL antibody, CGRPR antibody, CRLR antibody, AV071593 antibody, CLR antibody, Crlr antibody, RATCRLR antibody, RNCLR antibody, calcitonin receptor like receptor antibody, calcitonin receptor-like antibody, calcitonin receptor like receptor L homeolog antibody, CALCRL antibody, LOC100168906 antibody, calcrl antibody, Calcrl antibody, calcrl.L antibody

Background: CALCRL is the receptor for calcitonin-gene-related peptide (CGRP) together with RAMP1 and receptor for adrenomedullin together with RAMP2 or RAMP3. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Molecular Weight: 53 kDa (MW of target protein)

Pathways: cAMP Metabolic Process