PPP1R13B antibody

Catalog No. ABIN634596

This anti-PPP1R13B antibody is a Rabbit Polyclonal antibody detecting PPP1R13B in WB. Suitable for Human, Mouse and Rat.

Quick Overview for PPP1R13B antibody (ABIN634596)

Target: PPP1R13B (Protein Phosphatase 1, Regulatory Subunit 13B (PPP1R13B))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPP1R13B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PPP1R13B Antibody

Purification: Affinity purified

Immunogen: PPP1 R11 antibody was raised using a synthetic peptide corresponding to a region with amino acids EFDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPP1R13B Blocking Peptide, (ABIN937786), is also available for use as a blocking control in assays to test for specificity of this PPP1R13B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPP1R13B

Target: PPP1R13B (Protein Phosphatase 1, Regulatory Subunit 13B (PPP1R13B))

Alternative Name: PPP1R13B

Background: PPP1R13B is a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. ASPP proteins are required for the induction of apoptosis by p53-family proteins. They promote DNA binding and transactivation of p53-family proteins on the promoters of proapoptotic genes. Expression of this gene is regulated by the E2F transcription factor.

Molecular Weight: 119 kDa (MW of target protein)

Pathways: p53 Signaling