Ig antibody

Catalog No. ABIN634611

Product Details anti-Ig Antibody

Target: Ig

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Ig antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ARHGDIG antibody was raised using a synthetic peptide corresponding to a region with amino acids DEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARHGDIG Blocking Peptide, catalog no. 33R-1892, is also available for use as a blocking control in assays to test for specificity of this ARHGDIG antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGDIG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Ig

Target: Ig

Abstract: Ig Products

Synonyms: ATPIG antibody, ATPIQ antibody, A330005H02Rik antibody, AI315324 antibody, Ig antibody, ATPase phospholipid transporting 11C antibody, ATPase, class VI, type 11C antibody, ATP11C antibody, Atp11c antibody

Background: ARHGDIG is highly expressed in the entire brain, with regional variations. The mRNA is also present at high levels in kidney and pancreas and at moderate levels in spinal cord, stomach, and pituitary gland. ARHGDIG is mapped to chromosome band 16p13.3 which is rich in deletion mutants of genes involved in several human diseases, notably polycystic kidney disease, alpha-thalassemia, tuberous sclerosis, mental retardation, and cancer.

Molecular Weight: 25 kDa (MW of target protein)