MYBPH antibody (N-Term)

Catalog No. ABIN634622

Product Details anti-MYBPH Antibody

Target: MYBPH (Myosin Binding Protein H (MYBPH))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MYBPH antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MYBPH antibody was raised against the N terminal of MYBPH

Purification: Affinity purified

Immunogen: MYBPH antibody was raised using the N terminal of MYBPH corresponding to a region with amino acids LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MYBPH Blocking Peptide, catalog no. 33R-4913, is also available for use as a blocking control in assays to test for specificity of this MYBPH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYBPH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MYBPH

Target: MYBPH (Myosin Binding Protein H (MYBPH))

Alternative Name: MYBPH (MYBPH Products)

Synonyms: MGC64588 antibody, MYBPH antibody, MGC143401 antibody, MGC108122 antibody, AI385643 antibody, MyBP-H antibody, myosin binding protein H S homeolog antibody, myosin binding protein H antibody, mybph.S antibody, MYBPH antibody, mybph antibody, Mybph antibody

Background: MYBPH binds to myosin, probably involved in interaction with thick myofilaments in the A-band.

Molecular Weight: 52 kDa (MW of target protein)