Transglutaminase 2 antibody
-
- Target See all Transglutaminase 2 (TGM2) Antibodies
- Transglutaminase 2 (TGM2) (Transglutaminase 2 (C Polypeptide, Protein-Glutamine-gamma-Glutamyltransferase) (TGM2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Transglutaminase 2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Transglutaminase 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNY
- Top Product
- Discover our top product TGM2 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Transglutaminase 2 Blocking Peptide, catalog no. 33R-5634, is also available for use as a blocking control in assays to test for specificity of this Transglutaminase 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGM2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Transglutaminase 2 (TGM2) (Transglutaminase 2 (C Polypeptide, Protein-Glutamine-gamma-Glutamyltransferase) (TGM2))
- Alternative Name
- Transglutaminase 2 (TGM2 Products)
- Background
- Transglutaminases are enzymes that catalyze the crosslinking of proteins by epsilon-gamma glutamyl lysine isopeptide bonds. While the primary structure of transglutaminases is not conserved, they all have the same amino acid sequence at their active sites and their activity is calcium-dependent. TGM2 acts as a monomer, is induced by retinoic acid, and appears to be involved in apoptosis.
- Molecular Weight
- 77 kDa (MW of target protein)
- Pathways
- Tube Formation, Thromboxane A2 Receptor Signaling
-