MFAP4 antibody (N-Term)

Catalog No. ABIN634642

This Rabbit Polyclonal antibody specifically detects MFAP4 in WB. It exhibits reactivity toward Human and Rat.

Quick Overview for MFAP4 antibody (N-Term) (ABIN634642)

Target: MFAP4 (Microfibrillar-Associated Protein 4 (MFAP4))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MFAP4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MFAP4 Antibody

Binding Specificity: N-Term

Specificity: MFAP4 antibody was raised against the N terminal of MFAP4

Purification: Affinity purified

Immunogen: MFAP4 antibody was raised using the N terminal of MFAP4 corresponding to a region with amino acids TEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MFAP4 Blocking Peptide, (ABIN5614737), is also available for use as a blocking control in assays to test for specificity of this MFAP4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFAP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MFAP4

Target: MFAP4 (Microfibrillar-Associated Protein 4 (MFAP4))

Alternative Name: MFAP4

Background: MFAP4 is a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene encoding MFAP4 is located within the Smith-Magenis syndrome region.

Molecular Weight: 29 kDa (MW of target protein)