Osteomodulin antibody (Middle Region)

Catalog No. ABIN634647

The Rabbit Polyclonal anti-Osteomodulin antibody (ABIN634647) specifically detects Osteomodulin in WB. The antibody is reactive with Human and Mouse samples.

Quick Overview for Osteomodulin antibody (Middle Region) (ABIN634647)

Target: Osteomodulin (OMD)

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Osteomodulin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Osteomodulin Antibody

Binding Specificity: Middle Region

Specificity: Osteomodulin antibody was raised against the middle region of OMD

Purification: Affinity purified

Immunogen: Osteomodulin antibody was raised using the middle region of OMD corresponding to a region with amino acids LLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Osteomodulin Blocking Peptide, (ABIN5615151), is also available for use as a blocking control in assays to test for specificity of this Osteomodulin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OMD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Osteomodulin

Target: Osteomodulin (OMD)

Alternative Name: Osteomodulin

Background: OMD may be implicated in biomineralization processes. Has a function in binding of osteoblasts via the alpha(V)beta(3)-integrin.

Molecular Weight: 49 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process