Osteomodulin antibody (Middle Region)

Catalog No. ABIN634647

Product Details anti-Osteomodulin Antibody

Target: Osteomodulin (OMD)

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Osteomodulin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Osteomodulin antibody was raised against the middle region of OMD

Purification: Affinity purified

Immunogen: Osteomodulin antibody was raised using the middle region of OMD corresponding to a region with amino acids LLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Osteomodulin Blocking Peptide, catalog no. 33R-5180, is also available for use as a blocking control in assays to test for specificity of this Osteomodulin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OMD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Osteomodulin

Target: Osteomodulin (OMD)

Alternative Name: Osteomodulin (OMD Products)

Synonyms: si:ch211-103f16.5 antibody, OMD antibody, OSAD antibody, SLRR2C antibody, osteomodulin antibody, omd antibody, OMD antibody, Omd antibody

Background: OMD may be implicated in biomineralization processes. Has a function in binding of osteoblasts via the alpha(V)beta(3)-integrin.

Molecular Weight: 49 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process