SIPA1 antibody (Middle Region)

Catalog No. ABIN634653

Product Details anti-SIPA1 Antibody

Target: SIPA1 (Signal-Induced Proliferation-Associated 1 (SIPA1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SIPA1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SIPA1 antibody was raised against the middle region of SIPA1

Purification: Affinity purified

Immunogen: SIPA1 antibody was raised using the middle region of SIPA1 corresponding to a region with amino acids TAKPSVPSADSETPLTQDRPGSPSGSEDKGNPAPELRASFLPRTLSLRNS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SIPA1 Blocking Peptide, catalog no. 33R-8976, is also available for use as a blocking control in assays to test for specificity of this SIPA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIPA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SIPA1

Target: SIPA1 (Signal-Induced Proliferation-Associated 1 (SIPA1))

Alternative Name: SIPA1 (SIPA1 Products)

Synonyms: Spa1 antibody, SPA1 antibody, signal-induced proliferation-associated 1 antibody, Signal peptidase I (leader peptidase I) antibody, signal-induced proliferation associated gene 1 antibody, SIPA1 antibody, sipA1 antibody, Sipa1 antibody

Background: The product of this gene is a mitogen induced GTPase activating protein (GAP). It exhibits a specific GAP activity for Ras-related regulatory proteins Rap1 and Rap2, but not for Ran or other small GTPases.

Molecular Weight: 112 kDa (MW of target protein)

Pathways: Response to Water Deprivation