Connexin 43/GJA1 antibody (N-Term)

Catalog No. ABIN634661

The Rabbit Polyclonal anti-Connexin 43/GJA1 antibody has been validated for WB. It is suitable to detect Connexin 43/GJA1 in samples from Human, Rat, Mouse and Dog.

Quick Overview for Connexin 43/GJA1 antibody (N-Term) (ABIN634661)

Target: Connexin 43/GJA1 (GJA1) (Gap Junction Protein, alpha 1, 43kDa (GJA1))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Connexin 43/GJA1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Connexin 43/GJA1 Antibody

Binding Specificity: N-Term

Specificity: GJA1 antibody was raised against the N terminal of GJA1

Purification: Affinity purified

Immunogen: GJA1 antibody was raised using the N terminal of GJA1 corresponding to a region with amino acids LYLAHVFYVMRKEEKLNKKEEELKVAQTDGVNVDMHLKQIEIKKFKYGIE

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GJA1 Blocking Peptide, (ABIN5613769), is also available for use as a blocking control in assays to test for specificity of this GJA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Connexin 43/GJA1

Target: Connexin 43/GJA1 (GJA1) (Gap Junction Protein, alpha 1, 43kDa (GJA1))

Alternative Name: GJA1

Background: Gap junction protein, alpha 1 is a member of the connexin gene family and a component of gap junctions. Gap junctions are composed of arrays of intercellular channels and provide a route for the diffusion of materials of low molecular weight from cell to cell. Connexin 43 is the major protein of gap junctions in the heart, and gap junctions are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: MAPK Signaling, Myometrial Relaxation and Contraction, Cell-Cell Junction Organization