CD40 Ligand antibody

Catalog No. ABIN634665

This anti-CD40 Ligand antibody is a Rabbit Polyclonal antibody detecting CD40 Ligand in WB. Suitable for Human.

Quick Overview for CD40 Ligand antibody (ABIN634665)

Target: CD40 Ligand (CD40LG)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CD40 Ligand antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CD40 Ligand Antibody

Purification: Affinity purified

Immunogen: CD40 L antibody was raised using a synthetic peptide corresponding to a region with amino acids ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CD40L Blocking Peptide, (ABIN938001), is also available for use as a blocking control in assays to test for specificity of this CD40L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD40 G antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CD40 Ligand

Target: CD40 Ligand (CD40LG)

Alternative Name: CD40L

Background: CD40LG is expressed on the surface of T cells. It regulates B cell function by engaging CD40 on the B cell surface. A defect in this gene results in an inability to undergo immunoglobulin class switch and is associated with hyper-IgM syndrome.

Molecular Weight: 29 kDa (MW of target protein)

Pathways: NF-kappaB Signaling, Production of Molecular Mediator of Immune Response, Cancer Immune Checkpoints