CD40 Ligand antibody
-
- Target See all CD40 Ligand (CD40LG) Antibodies
- CD40 Ligand (CD40LG)
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CD40 Ligand antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- CD40 L antibody was raised using a synthetic peptide corresponding to a region with amino acids ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN
- Top Product
- Discover our top product CD40LG Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CD40L Blocking Peptide, catalog no. 33R-2615, is also available for use as a blocking control in assays to test for specificity of this CD40L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD40 G antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CD40 Ligand (CD40LG)
- Alternative Name
- CD40L (CD40LG Products)
- Background
- CD40LG is expressed on the surface of T cells. It regulates B cell function by engaging CD40 on the B cell surface. A defect in this gene results in an inability to undergo immunoglobulin class switch and is associated with hyper-IgM syndrome.
- Molecular Weight
- 29 kDa (MW of target protein)
- Pathways
- NF-kappaB Signaling, Production of Molecular Mediator of Immune Response, Cancer Immune Checkpoints
-