KIT Ligand antibody (Middle Region)

Catalog No. ABIN634669

This Rabbit Polyclonal antibody specifically detects KIT Ligand in WB. It exhibits reactivity toward Human, Mouse, Rat and Dog.

Quick Overview for KIT Ligand antibody (Middle Region) (ABIN634669)

Target: KIT Ligand (KITLG)

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KIT Ligand antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KIT Ligand Antibody

Binding Specificity: Middle Region

Specificity: KITLG antibody was raised against the middle region of KITLG

Purification: Affinity purified

Immunogen: KITLG antibody was raised using the middle region of KITLG corresponding to a region with amino acids TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KITLG Blocking Peptide, (ABIN5614363), is also available for use as a blocking control in assays to test for specificity of this KITLG antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KITLG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KIT Ligand

Target: KIT Ligand (KITLG)

Alternative Name: KITLG

Background: KITLG is the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway