ROM1 antibody (Middle Region)

Catalog No. ABIN634680

The Rabbit Polyclonal anti-ROM1 antibody (ABIN634680) specifically detects ROM1 in WB. The antibody is reactive with Human samples.

Quick Overview for ROM1 antibody (Middle Region) (ABIN634680)

Target: ROM1 (Retinal Outer Segment Membrane Protein 1 (ROM1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ROM1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ROM1 Antibody

Binding Specificity: Middle Region

Specificity: ROM1 antibody was raised against the middle region of ROM1

Purification: Affinity purified

Immunogen: ROM1 antibody was raised using the middle region of ROM1 corresponding to a region with amino acids NPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ROM1 Blocking Peptide, (ABIN5615915), is also available for use as a blocking control in assays to test for specificity of this ROM1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ROM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ROM1

Target: ROM1 (Retinal Outer Segment Membrane Protein 1 (ROM1))

Alternative Name: ROM1

Background: ROM1 is an integral membrane protein found in the photoreceptor disk rim of the eye. It can form homodimers or can heterodimerize with another photoreceptor, retinal degeneration slow (RDS). It is essential for disk morphogenesis, and may also function as an adhesion molecule involved in the stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. Certain defects in this gene have been associated with the degenerative eye disease retinitis pigmentosa.

Molecular Weight: 37 kDa (MW of target protein)