PCDH12 antibody (Middle Region)
-
- Target See all PCDH12 Antibodies
- PCDH12 (Protocadherin 12 (PCDH12))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PCDH12 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PCDH12 antibody was raised against the middle region of PCDH12
- Purification
- Affinity purified
- Immunogen
- PCDH12 antibody was raised using the middle region of PCDH12 corresponding to a region with amino acids SSRPFLLTTIVARDADSGANGEPLYSIRSGNEAHLFILNPHTGQLFVNVT
- Top Product
- Discover our top product PCDH12 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PCDH12 Blocking Peptide, catalog no. 33R-8846, is also available for use as a blocking control in assays to test for specificity of this PCDH12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDH12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PCDH12 (Protocadherin 12 (PCDH12))
- Alternative Name
- PCDH12 (PCDH12 Products)
- Background
- PCDH12 belongs to the protocadherin protein family, a subfamily of the cadherin superfamily. It consists of an extracellular domain containing 6 cadherin repeats, a transmembrane domain and a cytoplasmic tail that differs from those of the classical cadherins. The function of this cellular adhesion protein is undetermined but mouse protocadherin 12 does not bind catenins and appears to have no affect on cell migration or growth.
- Molecular Weight
- 126 kDa (MW of target protein)
- Pathways
- Cellular Glucan Metabolic Process
-