SSPN antibody
-
- Target See all SSPN Antibodies
- SSPN (Sarcospan (Kras Oncogene-Associated Gene) (SSPN))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SSPN antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Sarcospan antibody was raised using a synthetic peptide corresponding to a region with amino acids AHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKL
- Top Product
- Discover our top product SSPN Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Sarcospan Blocking Peptide, catalog no. 33R-1245, is also available for use as a blocking control in assays to test for specificity of this Sarcospan antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSPN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SSPN (Sarcospan (Kras Oncogene-Associated Gene) (SSPN))
- Alternative Name
- Sarcospan (SSPN Products)
- Synonyms
- DAGA5 antibody, KRAG antibody, NSPN antibody, SPN1 antibody, SPN2 antibody, Krag antibody, RGD1559723 antibody, sarcospan S homeolog antibody, sarcospan antibody, sspn.S antibody, SSPN antibody, Sspn antibody
- Background
- SSPN is a member of the dystrophin-glycoprotein complex (DGC). The DGC spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells.SSPN gene is expressed in a variety of tissues with highest levels in muscle, where alternative splice variants have been observed. In certain tumors KRAS2, SSPN, and ITPR2 are coamplified. The function of this gene is unknown.
- Molecular Weight
- 26 kDa (MW of target protein)
-