NINJ1 antibody (N-Term)

Catalog No. ABIN634689

Product Details anti-NINJ1 Antibody

Target: NINJ1 (Ninjurin 1 (NINJ1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NINJ1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Ninjurin 1 antibody was raised against the N terminal of NINJ1

Purification: Affinity purified

Immunogen: Ninjurin 1 antibody was raised using the N terminal of NINJ1 corresponding to a region with amino acids DSGTEEYELNGGLPPGTPGSPDASPARWGWRHGPINVNHYASKKSAAESM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Ninjurin 1 Blocking Peptide, catalog no. 33R-2165, is also available for use as a blocking control in assays to test for specificity of this Ninjurin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NINJ1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NINJ1

Target: NINJ1 (Ninjurin 1 (NINJ1))

Alternative Name: Ninjurin 1 (NINJ1 Products)

Synonyms: nin1 antibody, MGC79511 antibody, ninjurin antibody, NIN1 antibody, NINJURIN antibody, AU024536 antibody, ninjurin 1 antibody, ninjurin 1 L homeolog antibody, NINJ1 antibody, ninj1 antibody, ninj1.L antibody, Ninj1 antibody

Background: NINJ1 is a homophilic cell adhesion molecule that promotes axonal growth. NINJ1 may play a role in nerve regeneration and in the formation and function of other tissues.

Molecular Weight: 16 kDa (MW of target protein)