DLL1 antibody
-
- Target See all DLL1 Antibodies
- DLL1 (delta-Like 1 (DLL1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DLL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DLL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP
- Top Product
- Discover our top product DLL1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DLL1 Blocking Peptide, catalog no. 33R-3580, is also available for use as a blocking control in assays to test for specificity of this DLL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DLL1 (delta-Like 1 (DLL1))
- Alternative Name
- DLL1 (DLL1 Products)
- Background
- DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication.DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication.
- Molecular Weight
- 78 kDa (MW of target protein)
- Pathways
- Notch Signaling, Stem Cell Maintenance
-