DGCR2 antibody (Middle Region)

Catalog No. ABIN634699

This Rabbit Polyclonal antibody specifically detects DGCR2 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for DGCR2 antibody (Middle Region) (ABIN634699)

Target: DGCR2 (DGS2) (DiGeorge Syndrome Chromosome Region-2 (DGS2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DGCR2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DGCR2 Antibody

Binding Specificity: Middle Region

Specificity: DGCR2 antibody was raised against the middle region of DGCR2

Purification: Affinity purified

Immunogen: DGCR2 antibody was raised using the middle region of DGCR2 corresponding to a region with amino acids AESCYEKSSFLCKRSQTCVDIKDNVVDEGFYFTPKGDDPCLSCTCHGGEP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DGCR2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this DGCR2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGCR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DGCR2

Target: DGCR2 (DGS2) (DiGeorge Syndrome Chromosome Region-2 (DGS2))

Alternative Name: DGCR2

Background: Deletions of the 22q11.2 have been associated with a wide range of developmental defects classified under the acronym CATCH 22. The DGCR2 is a novel putative adhesion receptor protein, which could play a role in neural crest cells migration, a process which has been proposed to be altered in DiGeorge syndrome.

Molecular Weight: 61 kDa (MW of target protein)