ICAM5 antibody (N-Term)

Catalog No. ABIN634713

This anti-ICAM5 antibody is a Rabbit Polyclonal antibody detecting ICAM5 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for ICAM5 antibody (N-Term) (ABIN634713)

Target: ICAM5 (Intercellular Adhesion Molecule 5 (ICAM5))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ICAM5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ICAM5 Antibody

Binding Specificity: N-Term

Specificity: ICAM5 antibody was raised against the N terminal of ICAM5

Purification: Affinity purified

Immunogen: ICAM5 antibody was raised using the N terminal of ICAM5 corresponding to a region with amino acids RRNGTQRGLRWLARQLVDIREPETQPVCFFRCARRTLQARGLIRTFQRPD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ICAM5 Blocking Peptide, (ABIN5614130), is also available for use as a blocking control in assays to test for specificity of this ICAM5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ICAM5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ICAM5

Target: ICAM5 (Intercellular Adhesion Molecule 5 (ICAM5))

Alternative Name: ICAM5

Background: ICAM5 is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein is expressed on the surface of telencephalic neurons and displays two types of adhesion activity, homophilic binding between neurons and heterophilic binding between neurons and leukocytes.

Molecular Weight: 95 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, ER-Nucleus Signaling, Maintenance of Protein Location