Protocadherin alpha 4 (PCDHA4) (N-Term) antibody

Details for Product No. ABIN634733
Antigen
Epitope
N-Term
11
9
8
2
1
1
1
Reactivity
Human, Rat (Rattus)
27
4
3
3
3
3
3
2
1
1
1
1
Host
Rabbit
25
2
Clonality
Polyclonal
Conjugate
Un-conjugated
2
2
2
2
2
2
Application
Western Blotting (WB)
26
16
1
1
Options
Immunogen PCDHA4 antibody was raised using the N terminal of PCDHA4 corresponding to a region with amino acids VDRPLQVFHVDVEVRDINDNPPVFPATQKNLSIAESRPLDSRFPLEGASD
Specificity PCDHA4 antibody was raised against the N terminal of PCDHA4
Purification Affinity purified
Antigen
Alternative Name PCDHA4 (PCDHA4 Antibody Abstract)
Background The gene encoding PCDHA4 is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences.
Molecular Weight 99 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

PCDHA4 Blocking Peptide, catalog no. 33R-9478, is also available for use as a blocking control in assays to test for specificity of this PCDHA4 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA4 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Protocadherin alpha 4 (PCDHA4) (N-Term) antibody (ABIN634733) PCDHA4 antibody used at 1 ug/ml to detect target protein.