GJD2 antibody (Middle Region)

Catalog No. ABIN634734

Product Details anti-GJD2 Antibody

Target: GJD2 (Gap Junction Protein, delta 2, 36kDa (GJD2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GJD2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GJD2 antibody was raised against the middle region of GJD2

Purification: Affinity purified

Immunogen: GJD2 antibody was raised using the middle region of GJD2 corresponding to a region with amino acids ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GJD2 Blocking Peptide, catalog no. 33R-2564, is also available for use as a blocking control in assays to test for specificity of this GJD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GJD2

Target: GJD2 (Gap Junction Protein, delta 2, 36kDa (GJD2))

Alternative Name: GJD2 (GJD2 Products)

Synonyms: CX36 antibody, GJA9 antibody, Cx35.1 antibody, Cx36 antibody, GJD2 antibody, Gja9 antibody, connexin36 antibody, cx36 antibody, gap junction protein delta 2 antibody, gap junction protein, delta 2 antibody, GJD2 antibody, Gjd2 antibody

Background: GJD2 is a member of the connexin gene family that is expressed predominantly in mammalian neurons. Connexins associate in groups of 6 and are organized radially around a central pore to form connexons. Each gap junction intercellular channel is formed by the conjunction of 2 connexons.

Molecular Weight: 36 kDa (MW of target protein)