Mesothelin antibody (Middle Region)

Catalog No. ABIN634759

This Rabbit Polyclonal antibody specifically detects Mesothelin in WB. It exhibits reactivity toward Human.

Quick Overview for Mesothelin antibody (Middle Region) (ABIN634759)

Target: Mesothelin (MSLN)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Mesothelin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Mesothelin Antibody

Binding Specificity: Middle Region

Specificity: Mesothelin antibody was raised against the middle region of MSLN

Purification: Affinity purified

Immunogen: Mesothelin antibody was raised using the middle region of MSLN corresponding to a region with amino acids LKALLEVNKGHEMSPQAPRRPLPQVATLIDRFVKGRGQLDKDTLDTLTAF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Mesothelin Blocking Peptide, (ABIN940459), is also available for use as a blocking control in assays to test for specificity of this Mesothelin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSLN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Mesothelin

Target: Mesothelin (MSLN)

Alternative Name: Mesothelin

Background: An antibody that reacts with ovarian cancers and mesotheliomas was used to isolate a cell surface antigen named mesothelin. Although the function of mesothelin is unknown, it may play a role in cellular adhesion and is present on mesothelium and mesothelioma.

Molecular Weight: 33 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Positive Regulation of Peptide Hormone Secretion, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Carbohydrate Homeostasis, cAMP Metabolic Process, Regulation of G-Protein Coupled Receptor Protein Signaling, Positive Regulation of Endopeptidase Activity, Regulation of Carbohydrate Metabolic Process