DGCR2 antibody (N-Term)

Catalog No. ABIN634763

The Rabbit Polyclonal anti-DGCR2 antibody is suitable to detect DGCR2 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for DGCR2 antibody (N-Term) (ABIN634763)

Target: DGCR2 (DGS2) (DiGeorge Syndrome Chromosome Region-2 (DGS2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DGCR2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DGCR2 Antibody

Binding Specificity: N-Term

Specificity: DGCR2 antibody was raised against the N terminal of DGCR2

Purification: Affinity purified

Immunogen: DGCR2 antibody was raised using the N terminal of DGCR2 corresponding to a region with amino acids MVPKADSGAFLLLFLLVLTVTEPLRPELRCNPGQFACRSGTIQCIPLPWQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DGCR2 Blocking Peptide, (ABIN5613186), is also available for use as a blocking control in assays to test for specificity of this DGCR2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGCR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DGCR2

Target: DGCR2 (DGS2) (DiGeorge Syndrome Chromosome Region-2 (DGS2))

Alternative Name: DGCR2

Background: DGCR2 is the putative adhesion receptor that could be involved in cell-cell or cell-matrix interactions required for normal cell differentiation and migration.

Molecular Weight: 61 kDa (MW of target protein)