FGF21 antibody (N-Term)

Catalog No. ABIN634771

This Rabbit Polyclonal antibody specifically detects FGF21 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for FGF21 antibody (N-Term) (ABIN634771)

Target: FGF21 (Fibroblast Growth Factor 21 (FGF21))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FGF21 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FGF21 Antibody

Binding Specificity: N-Term

Specificity: FGF21 antibody was raised against the N terminal of FGF21

Purification: Affinity purified

Immunogen: FGF21 antibody was raised using the N terminal of FGF21 corresponding to a region with amino acids DSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FGF21 Blocking Peptide, (ABIN937543), is also available for use as a blocking control in assays to test for specificity of this FGF21 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGF21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FGF21

Target: FGF21 (Fibroblast Growth Factor 21 (FGF21))

Alternative Name: FGF21

Background: FGF21 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this growth factor has not yet been determined.

Molecular Weight: 19 kDa (MW of target protein)

Pathways: RTK Signaling