GMFG antibody (Middle Region)

Catalog No. ABIN634779

Product Details anti-GMFG Antibody

Target: GMFG (Glia Maturation Factor, gamma (GMFG))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GMFG antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GMF gamma antibody was raised against the middle region of GMFG

Purification: Affinity purified

Immunogen: GMF gamma antibody was raised using the middle region of GMFG corresponding to a region with amino acids KVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GMF gamma Blocking Peptide, catalog no. 33R-4701, is also available for use as a blocking control in assays to test for specificity of this GMF gamma antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GMFG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GMFG

Target: GMFG (Glia Maturation Factor, gamma (GMFG))

Alternative Name: GMF gamma (GMFG Products)

Synonyms: GMF-GAMMA antibody, 0610039G16Rik antibody, 2310057N07Rik antibody, AI324845 antibody, gmf-gamma antibody, MGC108238 antibody, zgc:136987 antibody, glia maturation factor gamma antibody, glia maturation factor, gamma antibody, glia maturation factor, gamma S homeolog antibody, GMFG antibody, Gmfg antibody, gmfg.S antibody, gmfg antibody

Background: The function of GMF gamma protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 17 kDa (MW of target protein)