Glucagon antibody (Middle Region)

Catalog No. ABIN634780

Product Details anti-Glucagon Antibody

Target: Glucagon (GCG)

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Glucagon antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Glucagon antibody was raised against the middle region of GCG

Purification: Affinity purified

Immunogen: Glucagon antibody was raised using the middle region of GCG corresponding to a region with amino acids VSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Glucagon Blocking Peptide, catalog no. 33R-9829, is also available for use as a blocking control in assays to test for specificity of this Glucagon antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Glucagon antibody is supplied as lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Glucagon

Target: Glucagon (GCG)

Alternative Name: Glucagon (GCG Products)

Synonyms: GLP1 antibody, GLP2 antibody, GRPP antibody, GLP-1 antibody, Glu antibody, PPG antibody, GCG antibody, gcg-A antibody, gcg1 antibody, glucagon antibody, glucagon L homeolog antibody, GCG antibody, Gcg antibody, gcg.L antibody

Background: GCG is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis.

Molecular Weight: 4 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, Peptide Hormone Metabolism, cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Negative Regulation of intrinsic apoptotic Signaling