PNOC antibody (Middle Region)
-
- Target See all PNOC Antibodies
- PNOC (Prepronociceptin (PNOC))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PNOC antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PNOC antibody was raised against the middle region of PNOC
- Purification
- Affinity purified
- Immunogen
- PNOC antibody was raised using the middle region of PNOC corresponding to a region with amino acids EQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQY
- Top Product
- Discover our top product PNOC Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PNOC Blocking Peptide, catalog no. 33R-2660, is also available for use as a blocking control in assays to test for specificity of this PNOC antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNOC antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PNOC (Prepronociceptin (PNOC))
- Alternative Name
- PNOC (PNOC Products)
- Background
- Nociceptin is the ligand of the opioid receptor-like receptor (OPRL1). It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. PNOC may be involved in neuronal differentiation and development.
- Molecular Weight
- 20 kDa (MW of target protein)
-