PNOC antibody (Middle Region)

Catalog No. ABIN634785

This anti-PNOC antibody is a Rabbit Polyclonal antibody detecting PNOC in WB. Suitable for Human, Mouse and Rat.

Quick Overview for PNOC antibody (Middle Region) (ABIN634785)

Target: PNOC (Prepronociceptin (PNOC))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PNOC antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PNOC Antibody

Binding Specificity: Middle Region

Specificity: PNOC antibody was raised against the middle region of PNOC

Purification: Affinity purified

Immunogen: PNOC antibody was raised using the middle region of PNOC corresponding to a region with amino acids EQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PNOC Blocking Peptide, (ABIN938046), is also available for use as a blocking control in assays to test for specificity of this PNOC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNOC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PNOC

Target: PNOC (Prepronociceptin (PNOC))

Alternative Name: PNOC

Background: Nociceptin is the ligand of the opioid receptor-like receptor (OPRL1). It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. PNOC may be involved in neuronal differentiation and development.

Molecular Weight: 20 kDa (MW of target protein)