Stanniocalcin 1 antibody (N-Term)

Catalog No. ABIN634788

Product Details anti-Stanniocalcin 1 Antibody

Target: Stanniocalcin 1 (STC1)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Stanniocalcin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: STC1 antibody was raised against the N terminal of STC1

Purification: Affinity purified

Immunogen: STC1 antibody was raised using the N terminal of STC1 corresponding to a region with amino acids MLQNSAVLLVLVISASATHEAEQNDSVSPRKSRVAAQNSAEVVRCLNSAL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STC1 Blocking Peptide, catalog no. 33R-6205, is also available for use as a blocking control in assays to test for specificity of this STC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Stanniocalcin 1

Target: Stanniocalcin 1 (STC1)

Alternative Name: STC1 (STC1 Products)

Synonyms: STC antibody, Stc antibody, stc1 antibody, MGC82280 antibody, STC1 antibody, zgc:153307 antibody, LOC777959 antibody, stanniocalcin 1 antibody, stanniocalcin 1 L homeolog antibody, stanniocalcin 1 S homeolog antibody, STC1 antibody, Stc1 antibody, stc1.L antibody, stc1.S antibody, stc1 antibody, LOC777959 antibody

Background: STC1 is a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. It contains 11 conserved cysteine residues and is phosphorylated by protein kinase C exclusively on its serine residues. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Overexpression of human stanniocalcin 1 in mice produces high serum phosphate levels, dwarfism, and increased metabolic rate.

Molecular Weight: 26 kDa (MW of target protein)

Pathways: Hormone Activity