Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

PDGFD antibody (N-Term)

PDGFD Reactivity: Human, Rat WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN634793
$836.98
Plus shipping costs $45.00
100 μL
Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target See all PDGFD Antibodies
    PDGFD (Platelet Derived Growth Factor D (PDGFD))
    Binding Specificity
    • 15
    • 12
    • 8
    • 7
    • 6
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    N-Term
    Reactivity
    • 63
    • 27
    • 19
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Human, Rat
    Host
    • 64
    • 8
    Rabbit
    Clonality
    • 66
    • 6
    Polyclonal
    Conjugate
    • 35
    • 6
    • 6
    • 5
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This PDGFD antibody is un-conjugated
    Application
    • 29
    • 27
    • 26
    • 12
    • 6
    • 5
    • 5
    • 5
    • 5
    • 3
    • 2
    • 2
    • 1
    Western Blotting (WB)
    Specificity
    PDGFD antibody was raised against the N terminal of PDGFD
    Purification
    Affinity purified
    Immunogen
    PDGFD antibody was raised using the N terminal of PDGFD corresponding to a region with amino acids NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    PDGFD Blocking Peptide, catalog no. 33R-6641, is also available for use as a blocking control in assays to test for specificity of this PDGFD antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDGFD antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C/-20 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    PDGFD (Platelet Derived Growth Factor D (PDGFD))
    Alternative Name
    PDGFD (PDGFD Products)
    Synonyms
    IEGF antibody, SCDGF-B antibody, SCDGFB antibody, Scdgfb antibody, rSCDGF-B antibody, PDGFD antibody, 1110003I09Rik antibody, platelet derived growth factor D antibody, platelet-derived growth factor, D polypeptide antibody, PDGFD antibody, Pdgfd antibody
    Background
    The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines.
    Molecular Weight
    40 kDa (MW of target protein)
    Pathways
    RTK Signaling, Platelet-derived growth Factor Receptor Signaling
You are here:
Support