PDGFD antibody (N-Term)
-
- Target See all PDGFD Antibodies
- PDGFD (Platelet Derived Growth Factor D (PDGFD))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PDGFD antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PDGFD antibody was raised against the N terminal of PDGFD
- Purification
- Affinity purified
- Immunogen
- PDGFD antibody was raised using the N terminal of PDGFD corresponding to a region with amino acids NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH
- Top Product
- Discover our top product PDGFD Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PDGFD Blocking Peptide, catalog no. 33R-6641, is also available for use as a blocking control in assays to test for specificity of this PDGFD antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDGFD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PDGFD (Platelet Derived Growth Factor D (PDGFD))
- Alternative Name
- PDGFD (PDGFD Products)
- Background
- The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines.
- Molecular Weight
- 40 kDa (MW of target protein)
- Pathways
- RTK Signaling, Platelet-derived growth Factor Receptor Signaling
-